Home Blog Page 16

“I Don’t Understand Why People Keep Saying I Haven’t Changed” — Mama Pat

0

Ghanaian evangelist Patricia Asiamah, popularly known as Agradaa, has declared that she is a changed and repentant person following her recent release from prison.

Speaking in an interview with Roman Fada on Atinka TV, the evangelist addressed growing public skepticism about her transformation, particularly criticisms fueled by her recent social media activity.

Agradaa questioned the basis of claims that she has not genuinely changed, arguing that many of her critics are themselves engaged in wrongdoing.

“When I hear that, I ask myself, those saying that, have they changed? Sometimes I don’t understand Ghanaians. Those saying that are engaged in gossip, fornication, robbery and others—have they changed?” she said.

She insisted that her repentance is sincere but emphasized that she cannot pretend to adopt a personality that is not authentic to her.

“They know I have repented but for the change, I don’t know what they are talking about because I can’t fake,” she added.

Reflecting on her past, Agradaa admitted she was previously involved in frequent online disputes and verbal exchanges. However, she stated that she has now made a conscious decision to avoid controversies and actions that contradict her faith.

According to her, some individuals she clashed with in the past may still harbor resentment and attempt to provoke her, but she remains committed to not engaging.

She stressed that her current focus is on her spiritual journey and ministry work, despite ongoing criticism from sections of the public.

Agradaa also addressed concerns about her energetic and outspoken demeanor, explaining that her lively personality is intentional and central to her evangelism.

She noted that her charisma helps draw attention, allowing her to effectively communicate her message and reach a wider audience.

According to the evangelist, her approach is not about self-promotion but about using her natural traits to spread the gospel. She added that she has no intention of changing this aspect of her personality, as she believes it enhances her ministry.

Video Of RNAQ’s Ex-Wife Joana Quaye’s Alleged Run-Down Home Surfaces After Delay’s Interview

0

A video purportedly showing the living conditions of Joana Quaye and her children has ignited widespread debate online, intensifying public scrutiny of Ghanaian businessman Richard Nii Armah Quaye following his recent media appearance.

The footage, shared on April 25, 2026, by Ghanaian comedienne Afia Schwarzenegger, allegedly captures a run-down and dilapidated environment said to be the residence of Quaye’s ex-wife and their children in Dansoman.

The controversy comes months after an Accra High Court ruling on January 20, 2026, which awarded Joana Quaye GH₵300,000 out of the GH₵5 million she had sought in the divorce settlement.

The court also granted her a one-third share of a house in Dansoman, GH₵5,000 monthly for the upkeep of their three children, along with other benefits.

The decision triggered mixed reactions online, particularly amid claims that Joana played a significant role in the early development of Quaye’s business empire.

Appearing on The Delay Show with Delay, Quaye dismissed assertions that his former wife contributed substantially to his financial success. He maintained that he was already financially stable prior to their marriage.

“So, if I had never had money, I couldn’t have married her because we had a luxurious wedding… I had money before I got married to her,” he said, adding that he owned a Volkswagen Passat before their union, which was used during their wedding.

Quaye also rejected allegations of neglect, insisting he provides fully for his children and remains actively involved in their lives.

However, the viral video shared by Afia Schwarzenegger has intensified criticism, with many social media users questioning the disparity between Quaye’s perceived wealth and the alleged state of his children’s living environment.

“This is where RNQ’s ex-wife and children stay at Dansoman 2026,” she captioned the video, suggesting that the footage contradicts Quaye’s claims of adequate care and support.

Afia Schwarzenegger further indicated that she intends to release additional evidence to challenge statements made by the businessman during his interview.

https://www.tiktok.com/@queenschwar/video/7632668127217732885

Richard Nii Armah Quaye Speaks On Children’s Travel Challenges Amid Co-Parenting Dispute

0

Ghanaian businessman Richard Nii Armah Quaye has opened up about difficulties surrounding his children’s ability to travel abroad, attributing the situation to ongoing disagreements with their mother, Joana Quaye.

Speaking during an appearance on The Delay Show hosted by Delay, Quaye disclosed that his children currently do not have visas, a situation he says has persisted due to complications linked to parental consent.

According to Quaye, attempts to secure travel visas for his children have repeatedly stalled due to objections raised during the application process.

“My children don’t have visas as I speak to you today, because their mother is so bitter to the extent that anytime I want something, she blocks it,” he stated.

He explained that responses from visa authorities often reference concerns from the children’s mother, which ultimately affect approval decisions.

“I can go and apply for a visa for my children, and the response I get is per mother is concerned, it won’t be approved,” he added.

Beyond the logistical setbacks, Quaye highlighted the emotional toll the situation has had on his children. He noted that they sometimes express a desire to travel abroad like their peers, often mentioning destinations such as London.

In response, he said he encourages them to seek their mother’s consent in hopes of facilitating the process.

Despite the travel limitations, Quaye emphasized his efforts to ensure his children still enjoy meaningful experiences within Ghana. He referenced videos showing moments spent together, including time aboard his private jet.

“The videos of them in my private jet, sometimes they just want to be in their daddy’s private jet,” he said.

According to him, trips are often limited to domestic destinations such as Kumasi and Tamale, where they spend time together.

@edwardaganesh

“My Children don’t have Visas because of their mother” 💔 – Richard Nii Armah Quaye on an interview with Delay. Credit @The Man #edwardaganesh #delayinterviews #rnaq #richardniiarmahquaye #delayinterviewsrichardniiarmahquaye

♬ suara asli – milenia – 🅄🅻🄸🅽🄽🆄🄷🅰

Yaa Yeboah Slams Unpaid Church Labour, Calls Some Pastors “Armed Robbers”

0

MC Yaa Yeboah has ignited debate over how some churches treat the people who keep their ministries running, accusing certain leaders of exploiting unpaid labour while collecting offerings from congregants.

Her remarks came during a conversation on compulsory tithing on UTV’s United Showbiz on April 25, 2026. In the course of the discussion, she questioned the way financial contributions are managed in some churches and pushed back against expectations placed on members who serve without compensation.

She maintained that tithing, in its true sense, was never designed as a pipeline for enriching church leadership. Instead, she said, it should serve as a support system for vulnerable members of the community and those who actively work within the church.

“The main concept of tithes should go to help the less-privileged in the church, widows, orphans, the aged, and even the workers in the church,” she said.

READ ALSO: Ghanaian Businesswoman Reveals How She Bought A G-Wagon By Selling Meat Pies

Turning to the issue of unpaid church workers, Yeboah sharply criticised the practice, arguing that denying people wages for their labour contradicts basic principles of fairness.

“So, if I go to a church and the pastor is preaching that if you are working in the house of the Lord you are not supposed to be paid, then you are an armed robber,” she added.

She also took aim at sermons that link financial giving to divine favour, describing such messaging as coercive and misleading.

“I have seen a video of a pastor saying that if you do not pay your tithes, God will not answer your prayers. That pastor is wicked,” she stated.

Expanding on her position, Yeboah challenged the belief that tithes must pass through church authorities to hold spiritual value. She suggested that direct acts of charity align more closely with what she interprets as the purpose of giving.

“From reading the Bible, if I save a tenth of my money and I use it to help beggars and widows on the street, God will answer my prayers,” MC Yaa Yeboah stated.

Below is a video of her statement.

Dede Chancelor Biography: From Smash TV Host to Business Strategist and Entrepreneur

0

The Dede Chancelor Biography has all the information regarding Dede Chancelor’s early life, including her date of birth and formal education, you would like to know as her proud follower.

Who Is Dede Chancelor?

After 20 Years Off Screen, Smash TV’s Dede Resurfaces With Big Boardroom Success

Dede Chancelor is a Ghanaian media personality, entrepreneur, and business strategist best known for hosting Smash TV and working with major media platforms such as Vibe FM, TV3, and Metro TV in the early 2000s.

She later transitioned into business, spending over two decades in the United States building ventures in real estate, logistics, and luxury resale. She is the founder of Chancelor Productions, a company focused on developing sustainable infrastructure for the African creative industry.

Early Life and Background

Dede Chancelor rose to prominence in Ghana during a period of rapid growth in television and radio broadcasting. Details about her early life and education remain limited in the public domain, but her early career reflects a strong foundation in media and communications.

Media Career in Ghana

Dede Chancelor became a recognizable figure in Ghana’s entertainment industry through her work across multiple platforms.

She gained popularity as:

  • A presenter on Vibe FM
  • A television personality on TV3 and Metro TV
  • The host of Smash TV, a widely followed entertainment program

In addition to hosting, she was known for her voice-over work on major advertising campaigns, including brands like Coca-Cola and Tigo.

Her presence during the early 2000s contributed significantly to Ghana’s evolving media landscape.

Why Did Dede Chancelor Leave Media?

Dede Chancelor stepped away from her media career at the height of her popularity, a move that generated public curiosity at the time.

Rather than continuing in broadcasting, she shifted her focus toward long-term business development and investment opportunities outside Ghana.

Business Career in the United States

After relocating to the United States, Dede Chancelor became involved in a private family-owned investment firm.

Her work focused on:

  • Real estate investment and property acquisitions
  • Logistics and fleet management operations
  • Business development and operational strategy

This phase of her career marked a transition from media visibility to business ownership and capital growth.

Entrepreneurial Ventures

Dede Chancelor expanded her business portfolio by entering the luxury resale market.

She is associated with Authentic Fab, a business specializing in authenticated designer goods. The venture targets the global demand for luxury fashion while emphasizing authenticity and quality control.

Return to Ghana

After approximately two decades abroad, Dede Chancelor returned to Ghana with a focus on contributing to the development of the local creative industry.

Her return has been positioned not as a media comeback, but as a strategic effort to build long-term systems within the industry.

Chancelor Productions

Chancelor Productions is a media and production company founded by Dede Chancelor.

The company aims to address structural challenges in the African creative sector by focusing on:

  • Intellectual property (IP) ownership for creators
  • Scalable production systems
  • Sustainable funding models

Unlike traditional production houses, the company operates with an emphasis on infrastructure and long-term value creation.

House of Chancelor

Dede Chancelor is also developing House of Chancelor, a lifestyle and fashion brand.

The brand is expected to combine:

  • Creative storytelling
  • Fashion and luxury commerce
  • Brand identity development

It represents an expansion of her business interests beyond media into lifestyle and consumer markets.

Impact on Ghana’s Creative Industry

Dede Chancelor’s work reflects a shift toward building sustainable systems within the creative economy.

Her contributions focus on:

  • Encouraging ownership among creatives
  • Promoting scalable business models
  • Supporting long-term industry growth

Her approach aligns with broader efforts to strengthen Africa’s position in the global creative sector.

Personal Philosophy

Dede Chancelor’s career is often associated with the concept of moving from visibility to ownership.

Her business approach emphasizes:

  • Long-term investment over short-term popularity
  • System building over individual recognition
  • Financial sustainability within creative industries

Legacy and Influence

Dede Chancelor is regarded as part of a generation of Ghanaian media personalities who helped shape modern broadcasting in the country.

Her transition into entrepreneurship positions her as an example of cross-industry career evolution, particularly among African professionals returning from abroad.

Media Appearances

Dede Chancelor has recently appeared in interviews discussing her return to Ghana and her business initiatives, including features on platforms such as 3Music TV.

VIDEO: “I Had My Money Before I Met Her” – Business Mogul Richard Nii Armah Finally Speaks Amid Divorce Brouhaha

0

Ghanaian business magnate Richard Nii Armah Quaye has finally broken his silence following the social media talks surrounding his divorce from his ex-wife, Joana Coffie.

In snippets of an upcoming interview with media personality Deloris Frimpong Manso, popularly known as Delay, shared online on Friday, April 24, 2026, the founder of Bills Micro Credit Limited strongly refuted claims that his ex-wife played a defining role in building his wealth.

VIDEO: Legendary Actor “Master Richard” Enstooled As Acting Chief Of Adomorobe

0

Popular Ghanaian actor and brand influencer Mikki Osei Berko, widely known in the entertainment industry as “Master Richard,” has reportedly been enstooled as the acting chief of Adomorobe, taking on the stool name Nana Osei Boakye Yiadom II.

The celebrated actor, who rose to fame through the iconic TV series Taxi Driver, was officially installed in a traditional ceremony witnessed by elders, kingmakers, and members of the community. His enstoolment marks a significant transition from the world of entertainment into traditional leadership.

After 20 Years Off Screen, Smash TV’s Dede Resurfaces With Big Boardroom Success

From Smash TV to Strategic Powerhouse, Dede Chancelor Returns to Transform Ghana’s Creative Economy

Ghanaians who grew up in the early 2000s, watching Ghanaian television and radio, Dede Chancelor was more than a presenter — she was a symbol of a booming media era.

From the vibrant airwaves of Vibe FM to prime-time dominance on TV3 and Metro TV, her voice and presence defined a generation. As the iconic host of Smash TV and a recognizable voice behind major brands like Coca-Cola and Tigo, Dede became one of the most influential media personalities of her time.

Today, ZionFelix.net reports on Smash Tv’s personality, Dede — after two decades of strategic enterprise-building in the United States and returning to her roots.

Beyond the Spotlight: From Public Recognition to Private Equity

At a time when her career was at peak and being remembered publicly as the host of Smash TV and the voice behind iconic Coca-Cola and Tigo campaigns, Dede made a bold and unexpected move by stepping away from the spotlight. For years, fans and industry watchers speculated about her absence.

But behind the scenes, she wasn’t stepping back — she was stepping up.

The 20-Year Power Move: Building Beyond Visibility

During her time in the United States, Dede Chancelor executed what can only be described as a long-term strategic pivot.

She became a key player in a private, family-owned investment firm, gaining hands-on experience in high-value sectors like Real Estate and logistics, managing large-scale property acquisitions and fleet operations.

Simultaneously, she tapped into the global appetite for luxury through Authentic Fab, a high-end resale business specializing in authenticated designer goods. This helped to positioned herself within an elite international commerce space.

Not a Comeback—A Strategic Return

Now, after 20 years, Dede Chancelor is back — but this is not a comeback story.

This is a calculated return with a mission into Ghana’s creative space and anchored by Chancelor Productions. This is the next-generation media company designed to solve one of the industry’s biggest challenges includes:

  • Capital Alignment: Bridging the gap between institutional investors and high-potential African storytellers.
  • IP Structuring: Creating legal and financial frameworks that ensure African creators own the “master tapes” of their cultural output.
  • Global Distribution: Leveraging her Western networks to ensure African content isn’t just produced locally but also monetized globally.

Beyond Media: Building a Lifestyle Empire

Dede’s vision extends far beyond television.

She is currently developing House of Chancelor, a premium lifestyle and fashion brand rooted in craftsmanship, storytelling, and brand identity. The goal is to merge media influence with tangible luxury — creating a cross-sector ecosystem that bridges creativity and commerce.

A New Kind of Returnee Entrepreneur

Dede Chancelor represents a new wave of African entrepreneurs returning home—not to participate, but to transform.

She is shifting from being the face on the screen to the architect behind the system.

In her world, the goal isn’t relevance — it’s permanence.

And with her strategic approach, she is positioning Ghana’s creative industry for exactly that.

In summary, from The Screens To The Boardroom, Smash TV’s Dede Reemerges After Two Decades as reported by ZionFelix.

Stonebwoy Reveals Military Dream As He Gears Up For BHIM Fest London Debut

0

Stonebwoy has revealed that his life might have taken a very different direction if music had not worked out. The popular Ghanaian artiste indicated that he likely would have joined the military.

Speaking on Off The Record in London, the Ghanaian artiste explained that his admiration for the armed forces comes from both personal interest and family influence, especially his father’s background as a former soldier.

He said the structure, discipline, and appearance of military life have long appealed to him.

“Personally, I would have loved to be a soldier. I just love the uniform and I love the discipline that comes with it. It fascinates me to be in the military. I love that because I’m one person who was grown like that, so I think the influence was right there. I love discipline. I love orderliness. Positivity aside everything,” he said.

READ ALSO: Sometimes You Need to Fail To Win – Medikal Reflects on His Journey

According to him, that sense of discipline was not just an outside admiration but something embedded in his upbringing. Still, he acknowledged that choosing music over a more conventional path initially caused friction at home.

“I mean, I had a little hurdle with my dad, because for whatever reason at first, but now it’s what it is. You can’t stop what it’s supposed to be. If I was to become a doctor, I’m not sure anybody could have stopped me. I would still have become a doctor,” Stonebwoy stated.

Apart from reflections on his early ambitions, Stonebwoy is preparing for a major international milestone with his flagship festival, BHIM Fest, set to debut in the United Kingdom.

The event will take place at OVO Arena Wembley on August 15, 2026, marking an expansion of the festival beyond West Africa.

VIDEO: Asantewaa Finally Reveals How She Met AMG Armani Before They Became Lovers

0

Ghanaian TikToker and social media influencer Asantewaa has finally opened up about how her love story with musician and entrepreneur AMG Armani began.

In a chat on a show dubbed Asantewaa Uncut Diaries, she disclosed that their first meeting dates back to 2024 when AMG Armani invited her to his birthday party.